DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and unc-4

DIOPT Version :9

Sequence 1:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster


Alignment Length:384 Identity:102/384 - (26%)
Similarity:138/384 - (35%) Gaps:124/384 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 IPHGAGGPTGSTLNTLMSQHRLLEFSRFGGLRGYDIAQHMLTQQGAVSKLLGSLRPPGLIGGSKP 165
            ||...|..:.::.|::.:.||.            :..||                   |:||| |
  Fly    41 IPEETGRSSSTSSNSIPNAHRT------------NAGQH-------------------LLGGS-P 73

  Fly   166 KVATPTVVSKIEQYKRENPTIFAWEIRERLISEGVCTNATAPSVSSINRILRNRAAERVATEFAR 230
            ..|..|.||..                 .:.|||                |...||.::....|:
  Fly    74 SSACSTSVSGC-----------------GMPSEG----------------LHPTAALQLYAAAAQ 105

  Fly   231 TAAYGLYPPPPHPYGSFTWHPAGNVPGGQGVPPPP---------------PPSALWSVAAPTLAN 280
            .|..|:..||..|:..|      .|||..| |..|               |.||..:.||..:|.
  Fly   106 LAPNGVRVPPWGPFLQF------GVPGVFG-PNGPFLGRPRFDAASAGGHPNSAAAAAAATQMAA 163

  Fly   281 LPPSAA---------------SAVPVSTCGSLSSA------HLMAGGAGGTPTNRAISPGSGSHD 324
            :..|.|               ||...:...:::|.      .||.|       ||...|.:|...
  Fly   164 VNASNAFANLTGLSAAALRNVSAAQTTAVAAVASTVATIQHRLMIG-------NRQSLPPAGPPS 221

  Fly   325 TLESADENRHIDSDYLDDDDEPKFRRNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSSRTSLSE 389
              |.::|:.....|..||....|.||:||.|:..||||||:.|..||||.:..||.|:.|..|.|
  Fly   222 --EGSNEDGGFPGDGDDDSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKE 284

  Fly   390 ARVQVWFSNRRAKWRRHQRMNLLKRQRSSPANPLHSQQSNDAPASSPTPSNHSSASTSA 448
            :||.|||.|||||.|:.:      ..:..|..|.|:.|.... :..|.|.|...|...|
  Fly   285 SRVAVWFQNRRAKVRKRE------HTKKGPGRPAHNAQPQTC-SGEPIPPNELKAKERA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_001014582.1 HTH 120..217 CDD:304362 16/96 (17%)
Homeobox 352..404 CDD:278475 30/51 (59%)
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 30/52 (58%)
NK <327..>368 CDD:302627 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450802
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.