DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and Mixl1

DIOPT Version :9

Sequence 1:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001099449.1 Gene:Mixl1 / 289311 RGDID:1310011 Length:231 Species:Rattus norvegicus


Alignment Length:251 Identity:73/251 - (29%)
Similarity:95/251 - (37%) Gaps:73/251 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 AAERVATEFARTAAYGLYPPPPHPYGSFTWHPAGN-VPGGQ---GVPPPPPPSALWSVAAPTLAN 280
            ||.....:||..||:..:|..         ||.|. :|..:   |:||.||.|.. ..|.|...:
  Rat     3 AAGSQQLQFAEGAAFPTFPAA---------HPGGQLLPAARPATGLPPAPPDSRA-PAATPCFPS 57

  Fly   281 LPPSAASAVPVSTCGSLSSAHLMAGGAGGTPTNRAISPGSGSHDTLESADENRHIDSDYLDDDDE 345
            ..|..|:..|                .|..|      ||........||.:              
  Rat    58 RGPRPAAQTP----------------TGLDP------PGPSKGSAAPSAPQ-------------- 86

  Fly   346 PKFRRNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSSRTSLSEARVQVWFSNRRAKWRRHQRMN 410
               ||.||:||.|||:.||..|.::.||.:..||||::.|.|.|:|:||||.|||||.|      
  Rat    87 ---RRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSR------ 142

  Fly   411 LLKRQRSSPANPLHSQQSNDAPASSPTPSNHSSASTSAPVAPVPPPQQPLPLCGDH 466
               ||......||.|::.:.  ...|.|...         |....||.||....:|
  Rat   143 ---RQSGKSFQPLSSRREDF--LHRPAPGTE---------ARCLKPQLPLEADVNH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_001014582.1 HTH 120..217 CDD:304362
Homeobox 352..404 CDD:278475 29/51 (57%)
Mixl1NP_001099449.1 PRK14971 <2..139 CDD:237874 56/184 (30%)
Homeobox 89..143 CDD:395001 30/62 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.