DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and Mixl1

DIOPT Version :9

Sequence 1:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_038757.1 Gene:Mixl1 / 27217 MGIID:1351322 Length:231 Species:Mus musculus


Alignment Length:256 Identity:78/256 - (30%)
Similarity:101/256 - (39%) Gaps:68/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 AAERVATEFARTAAYGLYPPPPHPYGSFTWHPAGNVPGGQGVPPPPPPSALWSVAAPTLANLPPS 284
            ||.....:||..||:.::|..         |     ||||.:|...|.|.|  .|||. .:..|:
Mouse     3 AAGSQQLQFAEGAAFPIFPAA---------H-----PGGQLLPAMRPASGL--PAAPH-DSRAPA 50

  Fly   285 AASAVPVSTCGSLSSAHLMAGGAGGTPTNRAISPGSGSHDTLESADENRHIDSDYLDDDDEPKFR 349
            |....|     :..|:......||..|      ||........||.:                 |
Mouse    51 ATQCFP-----NRDSSPTAQTPAGLDP------PGPSKGSAAPSAPQ-----------------R 87

  Fly   350 RNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSSRTSLSEARVQVWFSNRRAKWRRHQRMNLLKR 414
            |.||:||.|||:.||..|.::.||.:..||||::.|.|.|:|:||||.|||||.|         |
Mouse    88 RKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSR---------R 143

  Fly   415 QRSSPANPLHSQQSNDAPASSPTPSNHSSASTSAPVAPVPPPQQPLPLCGDHSPQGPPPSV 475
            |......||.|::.  .....|.|...         |....||.||....:|.|.   ||:
Mouse   144 QSGKSFQPLSSRRG--VFLHCPAPGTE---------ARCLKPQLPLEADVNHVPD---PSM 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_001014582.1 HTH 120..217 CDD:304362
Homeobox 352..404 CDD:278475 29/51 (57%)
Mixl1NP_038757.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..93 27/114 (24%)
Homeobox 89..142 CDD:278475 29/52 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.