DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and npax-1

DIOPT Version :9

Sequence 1:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_495533.2 Gene:npax-1 / 184779 WormBaseID:WBGene00017664 Length:176 Species:Caenorhabditis elegans


Alignment Length:174 Identity:43/174 - (24%)
Similarity:56/174 - (32%) Gaps:62/174 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 STGGIPHGAGGPTGSTLNTLMSQHRLLEFSRFGGLRGYDIAQHMLTQQGAVSKLLGSLRPPG--- 158
            ||.|   ..|.|..:||...:..:.||  |.|..|...:|:......:|...|.:|....||   
 Worm    14 STNG---STGSPPNNTLPPPIIPYSLL--SAFYSLSSANISTSPEINEGEKVKAVGRSYNPGRPL 73

  Fly   159 -----------------------LIGGSKPKVATPTVVSKI-EQYKRE---NPTIF-AWEIRERL 195
                                   |||      .|.:.|||| .:|:|.   .|..| |.|.:|. 
 Worm    74 CLEDRKKIVRLYEEGCRVSHIARLIG------VTHSCVSKIMSRYRRTGSVQPRSFRATENQEN- 131

  Fly   196 ISEGVCTNAT-------------APSVSSINRILRNRAAERVAT 226
                  .|||             .|...||.|||.....:.:.|
 Worm   132 ------DNATWQQQQLKQQQKKEKPLPFSIERILSPDIKKEIGT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_001014582.1 HTH 120..217 CDD:304362 34/140 (24%)
Homeobox 352..404 CDD:278475
npax-1NP_495533.2 HTH 60..>122 CDD:389747 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.