DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and Cphx1

DIOPT Version :9

Sequence 1:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_780551.1 Gene:Cphx1 / 105594 MGIID:2145733 Length:182 Species:Mus musculus


Alignment Length:111 Identity:24/111 - (21%)
Similarity:50/111 - (45%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 ESADENRHIDSDYLDDDDEPKFRRNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSSRTSLSEAR 391
            |:.|........|...:.:|:.:     ||.::|:.|::||..:.||..:|::.|:.:.....:.
Mouse    11 ETKDNRSKARKRYGSRNSKPRHK-----FSRDELKRLKQEFAYAPYPDFTTKDELARQFQCEVSV 70

  Fly   392 VQVWFSNRRAKW--RRHQRMNLLKRQRSSPANPLHSQQSNDAPASS 435
            :..||.|:||:.  ....:::.::|.|..........|....|.:|
Mouse    71 IDNWFQNKRARLAPELKSKISAMRRMRRCQDYMRTGHQDTQPPKAS 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_001014582.1 HTH 120..217 CDD:304362
Homeobox 352..404 CDD:278475 15/53 (28%)
Cphx1NP_780551.1 homeodomain 29..82 CDD:238039 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.