DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and sia3

DIOPT Version :10

Sequence 1:NP_524042.2 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:XP_002942209.2 Gene:sia3 / 100490453 XenbaseID:XB-GENE-480406 Length:247 Species:Xenopus tropicalis


Alignment Length:106 Identity:35/106 - (33%)
Similarity:51/106 - (48%) Gaps:21/106 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 RNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSSRTSLSEARVQVWFSNRRAKWRRHQRMNLLKR 414
            |.||.::.||.:.|:.:||.:.||...:|..::..|.:.|.|:||||.||||   ||    |.|.
 Frog   139 RKRTIYTKEQTDFLQNQFDINPYPDFVSRCHIAQLTGVPEPRIQVWFQNRRA---RH----LSKI 196

  Fly   415 QRSSPANPLHSQQSNDAPASSPTPSN------HSSASTSAP 449
            .|        ||:.....||:.|.:.      |.|.:..:|
 Frog   197 HR--------SQEPTIQEASTLTGTQKLISHVHQSTNPRSP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_524042.2 HTH_ARSR 120..217 CDD:481197
Homeodomain 349..405 CDD:459649 22/54 (41%)
sia3XP_002942209.2 COG5576 <123..236 CDD:227863 35/106 (33%)
Homeodomain 139..192 CDD:459649 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.