DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and ISX

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001290437.1 Gene:ISX / 91464 HGNCID:28084 Length:245 Species:Homo sapiens


Alignment Length:251 Identity:75/251 - (29%)
Similarity:105/251 - (41%) Gaps:86/251 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 GHNTNSGSGCGDSSAGSGRLSL----------PALSPD----SGSRDSRSPDADANRMIDIEGED 373
            |...|| .||.::..   :|||          ||...|    .|..:....:|.|:      |..
Human    12 GMERNS-LGCCEAPK---KLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEAAAS------GSG 66

  Fly   374 SESQDSDQPK-----FRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFS 433
            .|....|||:     .||.||||:.|||.||||.|..:|||.|:.|.:||||..|.|||||:||.
Human    67 LEKPPKDQPQEGRKSKRRVRTTFTTEQLHELEKIFHFTHYPDVHIRSQLAARINLPEARVQIWFQ 131

  Fly   434 NRRAKWRRHQRV-NL-IKQRDSPSTSSSPTPL-----------VNPVVSPVS------------- 472
            |:|||||:.::: || ..|:.|.::.:.||.|           :..:..|.|             
Human   132 NQRAKWRKQEKIGNLGAPQQLSEASVALPTNLDVAGPTWTSTALRRLAPPTSCCPSAQDQLASAW 196

  Fly   473 ----------------PIP--------VPVPVAVPESGQQKQPYPYSTSNMCNTSS 504
                            |:|        :||...:|      .|:| ...::|.||:
Human   197 FPAWITLLPAHPWETQPVPGLPIHQTCIPVLCILP------PPHP-KWGSICATST 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 33/51 (65%)
ISXNP_001290437.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..86 13/53 (25%)
Homeobox 86..138 CDD:278475 33/51 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.