DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and MIXL1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001269331.1 Gene:MIXL1 / 83881 HGNCID:13363 Length:240 Species:Homo sapiens


Alignment Length:308 Identity:83/308 - (26%)
Similarity:115/308 - (37%) Gaps:101/308 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 AERAAAEFARAASYGYAIHPTHPHPYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQPGGSG 298
            ||..|.:||..|::     |.:..|:......|...|....:| |.|.|.|||...|.|      
Human     4 AESRALQFAEGAAF-----PAYRAPHAGGALLPPPSPAAALLP-APPAGPGPATFAGFL------ 56

  Fly   299 SSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDADA 363
               |.|...:..|.:|                           |..||  |..|   :.:|.|  
Human    57 ---GRDPGPAPPPPAS---------------------------LGSPA--PPKG---AAAPSA-- 84

  Fly   364 NRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARV 428
                        ||       ||.||:||.|||..||..|.::.||.::.||:|||.|.|.|:|:
Human    85 ------------SQ-------RRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRI 130

  Fly   429 --------QVWFSNRRAKWRRHQ--------RVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVP 477
                    ||||.|||||.||..        |..:|....:|.|.:.......|:...|:.:|.|
Human   131 QLLFSPLFQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEP 195

  Fly   478 VPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINP--GSKMSS 523
            ..|.               ..:.::||...|.:.|:.::.  |||:.|
Human   196 NGVG---------------GGISDSSSQGQNFETCSPLSEDIGSKLDS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 30/59 (51%)
MIXL1NP_001269331.1 Homeobox 89..150 CDD:278475 30/60 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.