Sequence 1: | NP_524041.2 | Gene: | toe / 39418 | FlyBaseID: | FBgn0036285 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001323262.1 | Gene: | HDG12 / 838371 | AraportID: | AT1G17920 | Length: | 687 | Species: | Arabidopsis thaliana |
Alignment Length: | 244 | Identity: | 51/244 - (20%) |
---|---|---|---|
Similarity: | 80/244 - (32%) | Gaps: | 90/244 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 372 EDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRR 436
Fly 437 A-KWRRHQRVN--------------------LIKQRDSPSTSSSPT------------------- 461
Fly 462 ----------------------PLVNPVVSPVSPIPVPVPVAVPESGQQKQPYPYSTSNMCN--- 501
Fly 502 -TSSSSSNSQPCNTINPGSKMSSKTSSVSSN---QHMEEPAAAVATASP 546 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toe | NP_524041.2 | HTH | 134..230 | CDD:304362 | |
Homeobox | 388..440 | CDD:278475 | 17/52 (33%) | ||
HDG12 | NP_001323262.1 | Homeobox | 27..77 | CDD:365835 | 16/51 (31%) |
START_ArGLABRA2_like | 210..436 | CDD:176884 | 7/24 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |