DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and HDG12

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001323262.1 Gene:HDG12 / 838371 AraportID:AT1G17920 Length:687 Species:Arabidopsis thaliana


Alignment Length:244 Identity:51/244 - (20%)
Similarity:80/244 - (32%) Gaps:90/244 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 EDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRR 436
            :.||::..::.|.|.:|.|  |.|:..||..|::..:|....|.:|:....|:..:::.||.|||
plant    11 DSSETEKKNKKKKRFHRHT--PHQIQRLESTFNECQHPDEKQRNQLSRELGLAPRQIKFWFQNRR 73

  Fly   437 A-KWRRHQRVN--------------------LIKQRDSPSTSSSPT------------------- 461
            . |..:|:|.:                    .||....||...||.                   
plant    74 TQKKAQHERADNCALKEENDKIRCENIAIREAIKHAICPSCGDSPVNEDSYFDEQKLRIENAQLR 138

  Fly   462 ----------------------PLVNPVVSPVSPIPVPVPVAVPESGQQKQPYPYSTSNMCN--- 501
                                  ||:||:  .|||:.:                 :.|....:   
plant   139 DELERVSSIAAKFLGRPISHLPPLLNPM--HVSPLEL-----------------FHTGPSLDFDL 184

  Fly   502 -TSSSSSNSQPCNTINPGSKMSSKTSSVSSN---QHMEEPAAAVATASP 546
             ..|.||.|.|.....|...:|....|:.:|   ..|||....:.|..|
plant   185 LPGSCSSMSVPSLPSQPNLVLSEMDKSLMTNIAVTAMEELLRLLQTNEP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 17/52 (33%)
HDG12NP_001323262.1 Homeobox 27..77 CDD:365835 16/51 (31%)
START_ArGLABRA2_like 210..436 CDD:176884 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.