DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and RLT2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001318738.1 Gene:RLT2 / 834441 AraportID:AT5G44180 Length:1694 Species:Arabidopsis thaliana


Alignment Length:355 Identity:64/355 - (18%)
Similarity:110/355 - (30%) Gaps:128/355 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 EGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSN 434
            ||...||:..     |:.:|.   .||:.||..:....||....|..|:.:..||:.::|:||.:
plant    11 EGCGGESKSK-----RKMKTA---AQLEVLENTYSAEPYPSEAIRADLSVKLNLSDRQLQMWFCH 67

  Fly   435 RRAKWR------RHQRVNLIKQRDSPSTSSSPTPLVN---------------------------- 465
            ||.|.|      :.||..|:    :|:...|..|.||                            
plant    68 RRLKERKSTTPSKRQRKELV----TPTAMESWEPPVNAGDLVAGNELDSRRAARGSGGSGVTVVR 128

  Fly   466 ----------------------------PVV----SPVSPIPVPVPVAVPESGQ-QKQPYPYSTS 497
                                        ||:    .|:.|....:|:.:|...: .:|.:..:..
plant   129 RFNEPSSAEVRAIGYVEAQLGERLRDNGPVLGMEFDPLPPGAFGMPIEMPSHRKATRQAFETNIY 193

  Fly   498 NMCNTSSSSSNSQPCNTIN-----PGSKMSSKTSSVSSNQHMEEPAAAVATASPTASAPLSMGGE 557
            ...:......:.:|.....     |.|: :..:..||.:.|...|...........||     |.
plant   194 VRSDVKPIKDHVRPIREYQFIPELPSSR-TDHSERVSPSHHFGVPLDGSVMRVSAVSA-----GH 252

  Fly   558 NSAFRALPMTLPMPMTLPTASAAAFALSFARQYIAKYMGTPLNLGHGSSPIQAQSGRDHQ----- 617
            ...::..|.       :|..:            :|.:.|.|   ||..||...:....:|     
plant   253 RDDYKISPQ-------IPNLN------------LATHQGKP---GHVYSPNLVEYDSPYQKSYMD 295

  Fly   618 -----------SEEREYEDEQEEEEVINVE 636
                       ..|||..:|.|:::.:.:|
plant   296 TAAQVHDDPFVKSEREVGNEDEDDDALQLE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 17/51 (33%)
RLT2NP_001318738.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.