DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Obox1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_082078.1 Gene:Obox1 / 71468 MGIID:1918718 Length:204 Species:Mus musculus


Alignment Length:149 Identity:40/149 - (26%)
Similarity:69/149 - (46%) Gaps:27/149 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 PALSPDSGSRDSRS-PDADANRMIDIEGEDSESQD-----SDQ-----------PKFRRNRTTFS 392
            |.::|.|.::.|.| |:   ..::..|.:....|.     ||:           .|||:.||.::
Mouse    41 PLVTPGSTTKSSLSVPE---RNLLKQESQGPSRQSGCMLLSDKYVNKQTGPMASRKFRKERTVYT 102

  Fly   393 PEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTS 457
            .||...|:|.||:..||......:||....:::..:::||.|.|||:||....|:  ::..|.::
Mouse   103 KEQQGLLQKHFDECQYPNKKKIVELALSVGVTKREIKIWFKNNRAKYRRMNLQNI--EQVLPESN 165

  Fly   458 SSPTPLVNPVVSPVSPIPV 476
            .|     :..||..:..||
Mouse   166 GS-----SKAVSESTHFPV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 18/51 (35%)
Obox1NP_082078.1 homeodomain 95..153 CDD:238039 21/57 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.