DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Hoxd9

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001166940.1 Gene:Hoxd9 / 688999 RGDID:1582908 Length:343 Species:Rattus norvegicus


Alignment Length:302 Identity:76/302 - (25%)
Similarity:104/302 - (34%) Gaps:113/302 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 AAAEFAR----------AASYGYAIHPTHP---------HPYTSFPTWPAHHP-----LWGAVPL 277
            ||||||.          :||:. |:....|         |||.|.|...|..|     .| ..||
  Rat    48 AAAEFASCSFAPKSSVFSASWS-AVAAQPPAAATMSGLYHPYVSPPPLAAAEPGRYVRSW-MEPL 110

  Fly   278 ATPPGGGPAGAGGALQPGGSGSS-----------------YG------------SDGNMSSNPNS 313
            ...|||  ||.||....||.|.|                 ||            :....||..:|
  Rat   111 PGFPGG--AGGGGGSGGGGGGGSGGPGPVPSPGGPANGRHYGIKPETGAAPAPSAASTSSSTSSS 173

  Fly   314 SNSNTTHSNGHNTNSGSG-----CGD-----------SSAGSGRLSLPAL-----------SPDS 351
            |:|..|..:....:.|||     |..           ::||:|    |.:           |..|
  Rat   174 SSSKRTECSAARESQGSGGPEFPCNSFLRDKAAAAAAAAAGNG----PGVGIGTGPGTGGSSEPS 234

  Fly   352 GSRDSRSPDADANRMIDIEGEDSESQDSDQPK-----------------FRRNRTTFSPEQLDEL 399
            ...|..||....        ::.|.|....|:                 .|:.|..::..|..||
  Rat   235 ACSDHPSPGCPL--------KEEEKQPPQPPQQQLDPNNPAANWIHARSTRKKRCPYTKYQTLEL 291

  Fly   400 EKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRR 441
            ||||..:.|...:.|.::|....|:|.:|::||.|||.|.::
  Rat   292 EKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 20/51 (39%)
Hoxd9NP_001166940.1 Hox9_act 1..>155 CDD:282473 33/110 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..196 22/84 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..267 8/54 (15%)
HOX 276..328 CDD:197696 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.