DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Nkx3-2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_008768461.2 Gene:Nkx3-2 / 682329 RGDID:1584617 Length:328 Species:Rattus norvegicus


Alignment Length:307 Identity:67/307 - (21%)
Similarity:105/307 - (34%) Gaps:116/307 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 GGPAGAGGALQPGG---------------------SGSSYGSDGNMSSNPNSSNSNTTHSNGHNT 326
            ||.|...|...|||                     :|:..|::.::.::|    :.|..:.||:.
  Rat    25 GGLAAPEGRPAPGGTEVAVAAAPAVCCWRLFGETEAGALGGAEDSLLASP----ARTRTAVGHSA 85

  Fly   327 NSGSG----------------CGD----SSAGSGRLSL-------------PALSPD-------S 351
            .|..|                |.|    |..|..|::|             ..:..|       |
  Rat    86 ESPGGWDSDSALSEENEGRRRCADVPGASGTGHARVTLGLEQHAAKDLEEEARIRSDSEMSASVS 150

  Fly   352 GSRDSRSPDADAN----RMIDIEG--------------EDSESQDSDQPKFRRNRTTFSPEQLDE 398
            |....|..|...:    |:..:.|              |:.|...:.:|:.:|:|..||..|:.|
  Rat   151 GDHSPRGEDGSVSPGGARVPGLCGTAGGGASSGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFE 215

  Fly   399 LEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTP- 462
            ||:.|:...|.....|..|||...|:|.:|::||.|||.|.:|       :|..:...:|:|.. 
  Rat   216 LERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKR-------RQMAADLLASAPAAK 273

  Fly   463 ---------------LVNPVVSPVSPIPVPVPVAVPESGQQKQPYPY 494
                           |...|:.|.|.:|:          |....|||
  Rat   274 KVAVKVLVRDDQRQYLPGEVLRPPSLLPL----------QPSYYYPY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 22/51 (43%)
Nkx3-2XP_008768461.2 Homeobox 204..258 CDD:395001 22/53 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.