DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Rhox4g

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001034787.1 Gene:Rhox4g / 664608 MGIID:3613394 Length:205 Species:Mus musculus


Alignment Length:187 Identity:48/187 - (25%)
Similarity:69/187 - (36%) Gaps:55/187 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 NGHNTNS-----GSGCGDSSAGSGRLSLPALSPD-----SGSRDSRSPDADANRMIDIEGEDSES 376
            ||..|.:     |.|..:..:|.|:....|:..|     ||.....:.|||.     ::..:.|.
Mouse    22 NGGKTQAVLPLDGEGRNEGESGLGQSGAAAVEGDKAEELSGEGGPAAGDADL-----MDNSNQED 81

  Fly   377 QDS-----------DQPKFR-------------------------RNRT---TFSPEQLDELEKE 402
            ||:           ::|..|                         :.|:   .|...||.|||:.
Mouse    82 QDTSGSAQEEEKLPEEPVLRDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHYNFQWWQLQELERI 146

  Fly   403 FDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSSS 459
            |.::|:.....|..||....:|||||..||..||..:||.|. .|....|:|..|.|
Mouse   147 FQQNHFIRAEERRHLARWIGVSEARVMTWFKKRREHFRRGQS-QLGMNDDAPVGSHS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 21/54 (39%)
Rhox4gNP_001034787.1 P-loop_NTPase 44..>126 CDD:304359 13/86 (15%)
homeodomain 129..187 CDD:238039 23/57 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.