DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and alx1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001038539.1 Gene:alx1 / 565176 ZFINID:ZDB-GENE-050419-191 Length:320 Species:Danio rerio


Alignment Length:278 Identity:87/278 - (31%)
Similarity:114/278 - (41%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 PGGSGSSYGSDGNMSSNPN---------------SSNSNTTHSN------GHNTNSGSGCGDSSA 337
            |...||.|..|..|.:..|               ...||..||:      ..|.:|.:.|...|.
Zfish    13 PAIKGSDYYMDQVMDTLDNVQYYNKASPKCVQAFPMQSNDQHSSMDRSSPCDNQSSVTYCAPKSE 77

  Fly   338 GSGRLSLPALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKE 402
            .|   ||.|:......|.|.:........:|..||..:|..|...| ||:||||:..||:||||.
Zfish    78 ES---SLHAMENCCSLRVSPATSGPDKTDLDELGEKCDSNVSSSKK-RRHRTTFTSAQLEELEKV 138

  Fly   403 FDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDS-----------PST 456
            |.|:|||.|..||:||.||.|:||||||||.|||||||:.:|...|:|..|           |.|
Zfish   139 FQKTHYPDVYVREQLAMRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISMLPRT 203

  Fly   457 SSSPTPLVNPVVSPVSPIPVPVPVAVPESGQQ--KQPYPYS----TSNMCNTSSSSSNSQPCNTI 515
            .|......|....|.:...|.....:|.....  ..|||:|    ........:...|....|.:
Zfish   204 DSYSQISNNLWTGPSAGSSVVSSCMIPRGSPPCVTSPYPHSPRAAEHGYVGFPNHQQNQFGVNHV 268

  Fly   516 NPGSKMSSKTSSVSSNQH 533
            :..:..:....:.|:|.|
Zfish   269 SLNNFFADSLLASSANSH 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 36/51 (71%)
alx1NP_001038539.1 Homeobox 123..176 CDD:278475 36/52 (69%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 180..320 20/107 (19%)
OAR 296..313 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 300..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.