DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and BARX1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_067545.3 Gene:BARX1 / 56033 HGNCID:955 Length:254 Species:Homo sapiens


Alignment Length:278 Identity:73/278 - (26%)
Similarity:97/278 - (34%) Gaps:75/278 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 RAAERAAAEFARAASYGYAIHPTHPHPYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQPGG 296
            |..|..||.|  ....|.|.|  .||.|.||.....         |..||  ||.||..|.....
Human     3 RPGEPGAARF--GPPEGCADH--RPHRYRSFMIEEI---------LTEPP--GPKGAAPAAAAAA 52

  Fly   297 SGS--SYGSDGNMSSNPNSSNSNTTHSNGHNTNSGS---------GC-GDSSA----------GS 339
            :|.  .:|....:::.|..|     |.........:         || |.|||          .:
Human    53 AGELLKFGVQALLAARPFHS-----HLAVLKAEQAAVFKFPLAPLGCSGLSSALLAAGPGLPGAA 112

  Fly   340 GRLSLPALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFD 404
            |...||......|..::..|           ||..    :...|.||:||.|:..||..|||.|:
Human   113 GAPHLPLELQLRGKLEAAGP-----------GEPG----TKAKKGRRSRTVFTELQLMGLEKRFE 162

  Fly   405 KSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTPLVNPVVS 469
            |..|.....|..||....||:.:|:.|:.|||.||::     ::.|...             :.|
Human   163 KQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKK-----IVLQGGG-------------LES 209

  Fly   470 PVSPIPVPVPVAVPESGQ 487
            |..|...|...::|.|.|
Human   210 PTKPKGRPKKNSIPTSEQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 22/51 (43%)
BARX1NP_067545.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 6/18 (33%)
Homeobox 145..199 CDD:395001 23/53 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..254 7/37 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.