DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and lhx6b

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_685757.5 Gene:lhx6b / 557579 ZFINID:ZDB-GENE-060531-41 Length:286 Species:Danio rerio


Alignment Length:76 Identity:28/76 - (36%)
Similarity:43/76 - (56%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 RRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIK 449
            :|.||:|:.||:..::..|.:...|...|.::||..|.||...:||||.|.||:.:|....:.|.
Zfish   181 KRPRTSFTSEQIQIMQTHFIRDKNPDAATLQRLADTTGLSRRVIQVWFQNCRARQKRIPLHDSIP 245

  Fly   450 QRDSPSTSSSP 460
            :||...||:.|
Zfish   246 ERDRYQTSAMP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 20/51 (39%)
lhx6bXP_685757.5 LIM 32..86 CDD:295319
LIM 94..148 CDD:295319
Homeobox 183..236 CDD:278475 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.