DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and hmx2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001108570.3 Gene:hmx2 / 555632 ZFINID:ZDB-GENE-080506-2 Length:269 Species:Danio rerio


Alignment Length:248 Identity:62/248 - (25%)
Similarity:100/248 - (40%) Gaps:64/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 GSSYGSDGNMSSNPNSSNS-----NTTHSNGHNTNSGSGCGDS---------------------S 336
            |:|  :||..|:..:|..|     ..:.|:..:.::|...||.                     .
Zfish    26 GTS--NDGVRSAGKDSPKSQPRKRTLSVSSEDDCSAGEDSGDCYCSEPGVPESCNPHQPLNFCLG 88

  Fly   337 AGSGRLSL-----------PALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQPKFRRN--- 387
            |..|.|.:           |::.||......|:    .::|..:    ||.:..|.|..:.|   
Zfish    89 ATKGLLPVQDGIDRRPHLTPSILPDYKEEQGRA----CSQMSPV----SEDRQRDGPDKQNNSAK 145

  Fly   388 ---RTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIK 449
               ||.||..|:.:||..||...|...:.|..||:...|:|.:|:.||.|||.||:|.....|  
Zfish   146 KKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAEL-- 208

  Fly   450 QRDSPSTSSSPTPLVNPVV---SPVSPIPVPVPVAVPESGQQKQPYPYSTSNM 499
            :..:.:.:|:.|.:..|:|   :.:..:|||..:|.|      .|..|..||:
Zfish   209 EAANMAHASAQTLVGMPLVFRENSLLRVPVPRSIAFP------TPLYYPGSNL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 22/51 (43%)
hmx2NP_001108570.3 Homeobox 148..201 CDD:306543 22/52 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.