DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and lhx9

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001032320.2 Gene:lhx9 / 550405 ZFINID:ZDB-GENE-050417-210 Length:396 Species:Danio rerio


Alignment Length:215 Identity:56/215 - (26%)
Similarity:87/215 - (40%) Gaps:68/215 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 SGCGDSSAGSGR-LSLPALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQ------PKFRRN 387
            :|.|....|..| ...||:..|.||..|...:.||:.:           |.||      .|.:|.
Zfish   217 NGTGTVQKGRPRKRKSPAMGIDIGSYSSGCNENDADHL-----------DRDQQPYPPSQKTKRM 270

  Fly   388 RTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRD 452
            ||:|...||..::..|..:|.|.....::||.:|.|::..:||||.|.|||:||    |:::|.:
Zfish   271 RTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR----NVLRQEN 331

  Fly   453 S----------------------PSTSSSPTPLVNPVVSPVSPIPVPVPVAVPESGQQKQPYPYS 495
            .                      |||:::.|.|.||.::.|:.:                     
Zfish   332 GGVDKADGTSLPPPSSDSGALTPPSTATTLTDLTNPSITVVTSV--------------------- 375

  Fly   496 TSNMCNTSSSSSNSQPCNTI 515
            ||::   .|..|.|.|..|:
Zfish   376 TSSL---DSHESGSPPQTTL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 20/51 (39%)
lhx9NP_001032320.2 LIM1_Lhx2 61..124 CDD:188853
LIM2_Lhx2_Lhx9 129..187 CDD:188763
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..272 7/34 (21%)
Homeobox 271..323 CDD:278475 20/51 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..365 5/36 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..396 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.