DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and dmbx1b

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001017625.1 Gene:dmbx1b / 550288 ZFINID:ZDB-GENE-050417-97 Length:369 Species:Danio rerio


Alignment Length:297 Identity:84/297 - (28%)
Similarity:119/297 - (40%) Gaps:79/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 ANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEAR 427
            |.|:.||..|  ....|...|.||:||.|:.:||:.|||.|.|:|||.|..||:||..|.|.|||
Zfish    47 AERLADIILE--ARYGSQHRKQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEAR 109

  Fly   428 VQVWFSNRRAKWRRHQR------VNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPV---------- 476
            |||||.|||||:|:.||      :..:|:..:............||.:...|.|:          
Zfish   110 VQVWFKNRRAKFRKKQRSLQKEQLQRLKEAGTEGAQDEGKEEAPPVEAQAPPSPLDGRGLTSAPS 174

  Fly   477 -----PVPVAVP-----ESGQQ----KQPYPYSTSNMCN-------TSSSSSNSQPCNTINPGSK 520
                 .|.|..|     |||.:    ::..|.|..:...       |..||.:.:|         
Zfish   175 CELNEEVNVTSPEQSGAESGAEDTTDREDEPLSIKDEIKEAGPPLMTDDSSPSYKP--------- 230

  Fly   521 MSSKTSSVSSNQHMEEPAAAVATASPTASAPLS-----------MGGENSAFRALPMTLPMPMTL 574
            :|.|:.....:..:...:.|||.::..||:|||           |...|:........:..|.:|
Zfish   231 LSPKSDDPLVSPALPSSSGAVAQSNSYASSPLSLFRLQEQFRQHMAATNNLMHYPAFDVTAPSSL 295

  Fly   575 PTASAAAFALSFARQYIAKYMGTPLNLGH--GSSPIQ 609
            |                  |:|..:|:..  ||.|.|
Zfish   296 P------------------YLGVNVNMASPLGSLPCQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 33/51 (65%)
dmbx1bNP_001017625.1 Homeobox 69..122 CDD:278475 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..253 23/137 (17%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 346..359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.