DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and pitx2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001017227.1 Gene:pitx2 / 549981 XenbaseID:XB-GENE-482492 Length:345 Species:Xenopus tropicalis


Alignment Length:259 Identity:77/259 - (29%)
Similarity:120/259 - (46%) Gaps:68/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 GSGCGDSSAGSGRLSLPALSPDSGSRDSRSPD-ADANRMIDIEGEDSESQD-SDQPKFRRNRTTF 391
            |...|:..|   ||.:..:|      |:.||: ||.::....:.|||.:.| |.:.:.||.||.|
 Frog    65 GQRSGECKA---RLEVHTIS------DTSSPEAADKDKSHQSKNEDSSTDDPSKKKRQRRQRTHF 120

  Fly   392 SPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWR---RHQRVNLIKQRDS 453
            :.:||.|||..|.::.||.::|||::|..|.|:||||:|||.|||||||   |:|:..|.|....
 Frog   121 TSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFG 185

  Fly   454 P-----------------------------STSSSPTPLVNPV-VSPVSPIPVPVPVAVPESGQQ 488
            |                             |.|:...|..|.: |:|:|...:            
 Frog   186 PQFNGLMQPYDDMYPSYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSM------------ 238

  Fly   489 KQPYPYSTSNMCNTSSSSSNSQPCNTIN-PGSKMSSKTSSVSSNQHMEEPAAAVATASPTASAP 551
                 :|:.|..::.|.||...|..... |||.:    :|:::..::..|  ::.||.||::.|
 Frog   239 -----FSSPNSISSMSMSSGMVPSAVTGVPGSGL----NSLNNLNNLSNP--SLNTAVPTSACP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 29/51 (57%)
pitx2NP_001017227.1 XRCC4 <84..144 CDD:284132 23/59 (39%)
Homeobox 117..169 CDD:278475 29/51 (57%)
OAR 303..320 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.