Sequence 1: | NP_524041.2 | Gene: | toe / 39418 | FlyBaseID: | FBgn0036285 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017227.1 | Gene: | pitx2 / 549981 | XenbaseID: | XB-GENE-482492 | Length: | 345 | Species: | Xenopus tropicalis |
Alignment Length: | 259 | Identity: | 77/259 - (29%) |
---|---|---|---|
Similarity: | 120/259 - (46%) | Gaps: | 68/259 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 329 GSGCGDSSAGSGRLSLPALSPDSGSRDSRSPD-ADANRMIDIEGEDSESQD-SDQPKFRRNRTTF 391
Fly 392 SPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWR---RHQRVNLIKQRDS 453
Fly 454 P-----------------------------STSSSPTPLVNPV-VSPVSPIPVPVPVAVPESGQQ 488
Fly 489 KQPYPYSTSNMCNTSSSSSNSQPCNTIN-PGSKMSSKTSSVSSNQHMEEPAAAVATASPTASAP 551 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toe | NP_524041.2 | HTH | 134..230 | CDD:304362 | |
Homeobox | 388..440 | CDD:278475 | 29/51 (57%) | ||
pitx2 | NP_001017227.1 | XRCC4 | <84..144 | CDD:284132 | 23/59 (39%) |
Homeobox | 117..169 | CDD:278475 | 29/51 (57%) | ||
OAR | 303..320 | CDD:281777 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |