DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and hesx1

DIOPT Version :10

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001016712.1 Gene:hesx1 / 549466 XenbaseID:XB-GENE-483193 Length:186 Species:Xenopus tropicalis


Alignment Length:73 Identity:32/73 - (43%)
Similarity:47/73 - (64%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 RRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRR-HQRVNLI 448
            ||.||.|:..|::.||..|..:.||.::.||:||.:.||.|.|:|:||.|||||.:| |:....:
 Frog   110 RRPRTAFTRSQIEILENVFRVNSYPGIDIREELAGKLALDEDRIQIWFQNRRAKLKRSHRESQFL 174

  Fly   449 KQRDSPST 456
            ..:||.|:
 Frog   175 MVKDSLSS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH_ARSR 134..230 CDD:481197
Homeodomain 385..441 CDD:459649 27/55 (49%)
hesx1NP_001016712.1 Homeodomain 110..166 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.