DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Pitx2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001035970.1 Gene:Pitx2 / 54284 RGDID:3331 Length:324 Species:Rattus norvegicus


Alignment Length:243 Identity:74/243 - (30%)
Similarity:112/243 - (46%) Gaps:48/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 AGSGRLSLPALSPDSGSRDSRSPD-ADANRMIDIEGEDSESQD-SDQPKFRRNRTTFSPEQLDEL 399
            |...||.:..:|      |:.||: |:.::....:.||..::| |.:.:.||.||.|:.:||.||
  Rat    49 ASKHRLEVHTIS------DTSSPEVAEKDKGQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQEL 107

  Fly   400 EKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWR---RHQRVNLIKQRDSPSTSSSPT 461
            |..|.::.||.::|||::|..|.|:||||:|||.|||||||   |:|:..|.|....|.      
  Rat   108 EATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQ------ 166

  Fly   462 PLVNPVVSPVSPIPVP-------VPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTIN--- 516
              .|.::.|...: .|       ....:..:....:.:|:..|...|..||.|...|.|:|:   
  Rat   167 --FNGLMQPYDDM-YPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMS 228

  Fly   517 -------------PGSKMSS-----KTSSVSSNQHMEEPAAAVATASP 546
                         |||.::|     ..||.|.|..:..||...|..:|
  Rat   229 MSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 29/51 (57%)
Pitx2NP_001035970.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..111 19/59 (32%)
Homeobox 96..149 CDD:395001 30/52 (58%)
OAR 282..299 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 286..299
Nuclear localization signal. /evidence=ECO:0000255 292..296
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.