Sequence 1: | NP_524041.2 | Gene: | toe / 39418 | FlyBaseID: | FBgn0036285 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035970.1 | Gene: | Pitx2 / 54284 | RGDID: | 3331 | Length: | 324 | Species: | Rattus norvegicus |
Alignment Length: | 243 | Identity: | 74/243 - (30%) |
---|---|---|---|
Similarity: | 112/243 - (46%) | Gaps: | 48/243 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 337 AGSGRLSLPALSPDSGSRDSRSPD-ADANRMIDIEGEDSESQD-SDQPKFRRNRTTFSPEQLDEL 399
Fly 400 EKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWR---RHQRVNLIKQRDSPSTSSSPT 461
Fly 462 PLVNPVVSPVSPIPVP-------VPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTIN--- 516
Fly 517 -------------PGSKMSS-----KTSSVSSNQHMEEPAAAVATASP 546 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toe | NP_524041.2 | HTH | 134..230 | CDD:304362 | |
Homeobox | 388..440 | CDD:278475 | 29/51 (57%) | ||
Pitx2 | NP_001035970.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 57..111 | 19/59 (32%) | |
Homeobox | 96..149 | CDD:395001 | 30/52 (58%) | ||
OAR | 282..299 | CDD:397759 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 286..299 | ||||
Nuclear localization signal. /evidence=ECO:0000255 | 292..296 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |