DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and PRRX2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_057391.1 Gene:PRRX2 / 51450 HGNCID:21338 Length:253 Species:Homo sapiens


Alignment Length:269 Identity:80/269 - (29%)
Similarity:115/269 - (42%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 GGGPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSL-P 345
            |.||.....||.||                :.:.:....|..|..:.     :..|.:|||:. |
Human    16 GPGPPPPPPALGPG----------------DCAQARKNFSVSHLLDL-----EEVAAAGRLAARP 59

  Fly   346 ALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQP------------KFRRNRTTFSPEQLDE 398
            ....::....:|.|...::      |.::..||.:.|            |.|||||||:..||..
Human    60 GARAEAREGAAREPSGGSS------GSEAAPQDGECPSPGRGSAAKRKKKQRRNRTTFNSSQLQA 118

  Fly   399 LEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTPL 463
            ||:.|:::|||....||:||.|..||||||||||.|||||:||::|..|..:..|...|.|....
Human   119 LERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQEAA 183

  Fly   464 VNPVVSPVSPIPVPVPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMSSKTSSV 528
            :.   .||:|.|..:.   |:........||||....:..||...:...|..|..:.:..|....
Human   184 IE---QPVAPRPTALS---PDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEF 242

  Fly   529 SSNQHMEEP 537
            |.: |.:.|
Human   243 SLH-HSQVP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 32/51 (63%)
PRRX2NP_057391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 7/32 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..113 16/63 (25%)
Homeobox 109..161 CDD:395001 31/51 (61%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 230..243 2/12 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.