DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and PAX9

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001359005.1 Gene:PAX9 / 5083 HGNCID:8623 Length:341 Species:Homo sapiens


Alignment Length:258 Identity:89/258 - (34%)
Similarity:123/258 - (47%) Gaps:42/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LGGIFCGGSAAAGPGAAAAAATNLNALASQHRLLELSRFGLRGYDLAQHMLSQQGAVSKLLGTLR 168
            |||:|..|....            ||:  :.|::||::.|:|..|:::.:....|.|||:|....
Human    11 LGGVFVNGRPLP------------NAI--RLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYN 61

  Fly   169 P-----PGLIGGSKPKVATPTVVSKIEQYKRENPTIFAWEIRERLITEGVCTNATAPSVSSINRI 228
            .     ||.||||||:|.|||||..|..||:.:|.|||||||:||:.:|||.....||||||:||
Human    62 ETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRI 126

  Fly   229 LRNRAAERAAAEFARAASY-GYAIHPTHPH---PYTSFPTWPAHHPLWGAVPLATPPGGGPAGAG 289
            |||:     ....|:...| .|..|...|.   ||....::|:  |:..|......|.|.||..|
Human   127 LRNK-----IGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPS--PITAAAAKVPTPPGVPAIPG 184

  Fly   290 GALQPGGSGSSYG-SD--GNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSP 349
            ....|....||:. :|  |..|.....|:|:..||..         .:..:..||.:.||.:|
Human   185 SVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPK---------VEEWSSLGRNNFPAAAP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 49/100 (49%)
Homeobox 388..440 CDD:278475
PAX9NP_001359005.1 PAX 6..131 CDD:238076 59/138 (43%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 7..63 18/65 (28%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 82..130 29/47 (62%)
Interaction with KDM5B. /evidence=ECO:0000269|PubMed:12657635 168..189 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.