DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Tlx3

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_573065.4 Gene:Tlx3 / 497881 RGDID:1564190 Length:291 Species:Rattus norvegicus


Alignment Length:267 Identity:69/267 - (25%)
Similarity:97/267 - (36%) Gaps:74/267 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 HPHPYTSF-----------PTWPAHHPLWGAVPLATPPGGGPAGAGGALQP--GGSGSSYGSDGN 306
            |||...||           .:.||.....||..|..||||.|..|..:|..  .|.|:.:...|:
  Rat    11 HPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGAAYPSLPASFAGLGAPFEDAGS 75

  Fly   307 MSSNPNSSNSNTTHSNGHNTNSGS------------GCGDSSAGSGRLSLP-------------- 345
            .|.|.:.:.:.......|....|:            ....:.:..|.|:.|              
  Rat    76 YSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFT 140

  Fly   346 ---ALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSH 407
               ||:|.:.:|....|                .|:...||.::.||:||..|:.||||.|.:..
  Rat   141 AAAALTPFTVTRRIGHP----------------YQNRTPPKRKKPRTSFSRVQICELEKRFHRQK 189

  Fly   408 YPCVNTREKLAARTALSEARVQVWFSNRRAKWRRH------------QRVNLIKQRD----SPST 456
            |.....|..||....:::|:|:.||.|||.||||.            .|:.|..|.|    |.:.
  Rat   190 YLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLND 254

  Fly   457 SSSPTPL 463
            |..|.||
  Rat   255 SIQPDPL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 22/51 (43%)
Tlx3XP_573065.4 Homeobox 169..223 CDD:395001 23/53 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.