DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and AgaP_AGAP006537

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_001237835.2 Gene:AgaP_AGAP006537 / 4576611 VectorBaseID:AGAP006537 Length:271 Species:Anopheles gambiae


Alignment Length:187 Identity:49/187 - (26%)
Similarity:70/187 - (37%) Gaps:55/187 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 DSGSRDSRSP-DADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNT 413
            |.|:..|... |||.|      |::         |.:|.||||:.||:..|:..|.....|....
Mosquito   128 DDGTTSSEDGLDADGN------GKN---------KTKRIRTTFTEEQIQILQANFQVDSNPDGQD 177

  Fly   414 REKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPV 478
            .|::|..|.||:...||||.|.||:.::|                                 |.|
Mosquito   178 LERIALATGLSKRVTQVWFQNSRARQKKH---------------------------------VHV 209

  Fly   479 PVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQP----CNTINPGSKMSSKTSSVSSN 531
            |.|.......:.....:.:|.|  |||:||..|    ...:.|...:..|||..:|:
Mosquito   210 PRAQDLFNGMRSDLNNNNNNSC--SSSNSNDGPPGHHLGGVGPEDCVLGKTSIFNSH 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 21/51 (41%)
AgaP_AGAP006537XP_001237835.2 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.