DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and cdx1a

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_998001.2 Gene:cdx1a / 405762 ZFINID:ZDB-GENE-050510-1 Length:228 Species:Danio rerio


Alignment Length:264 Identity:71/264 - (26%)
Similarity:98/264 - (37%) Gaps:91/264 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ASYGYA---IHPTHPH----PYTSFPTWPAHHPLWGAVPLATPPGGGPA------GAGGALQPG- 295
            |.||..   ::.:.||    |...:|.:..:||             |||      ..|.:..|| 
Zfish    10 AMYGNPARHLNLSQPHLNVYPSAPYPDYSGYHP-------------GPALGNDLHHTGSSWSPGF 61

  Fly   296 GSGSS------YGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSR 354
            |.||.      ||                 |..||                  ||||    :|..
Zfish    62 GPGSRDDWPPLYG-----------------HGTGH------------------SLPA----NGVE 87

  Fly   355 DSRSPDADANRMIDIEGEDSESQD----SDQP-----KFR---RNRTTFSPEQLDELEKEFDKSH 407
            .|..|..|...:.....:..|.||    |..|     |.|   :.|..:|..|..||||||..|.
Zfish    88 VSVLPSVDQGLLSGAPVDREEPQDWMRRSAVPTNPGGKTRTKDKYRVVYSDVQRLELEKEFHFSR 152

  Fly   408 YPCVNTREKLAARTALSEARVQVWFSNRRAKWRR--HQRVNLIKQRDS-----PSTSSSPTPLVN 465
            |..:..:.:||....|||.:|::||.|||||.|:  .:|:..::|..|     .:.|||.:.|:.
Zfish   153 YITIRRKAELAGTLNLSERQVKIWFQNRRAKERKMNKKRLQQVQQSSSGLANTTTVSSSDSGLMT 217

  Fly   466 PVVS 469
            ..:|
Zfish   218 DNIS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 24/51 (47%)
cdx1aNP_998001.2 Caudal_act 11..115 CDD:282574 33/155 (21%)
COG5576 <122..227 CDD:227863 35/100 (35%)
Homeobox 133..185 CDD:278475 24/51 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.