DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and mnx1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001009885.1 Gene:mnx1 / 405399 ZFINID:ZDB-GENE-040409-1 Length:311 Species:Danio rerio


Alignment Length:330 Identity:73/330 - (22%)
Similarity:124/330 - (37%) Gaps:85/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 NATAPSVSSINRILRNRAAERAAAEFARAASYGYAIHP------------THPHPYTSFPTWPAH 268
            ::::.||.::.....:.|.:..:....|.:|.|....|            .||...|..|....:
Zfish    37 SSSSDSVQAVELTTNSDALQTESPSPPRISSCGLIPKPGFLNSPHSGMVGLHPQSSTGIPPQALY 101

  Fly   269 -HPL--WGAVPLATPPGGGPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGS 330
             ||:  :.|..|...|         ||       ||       |.|:.|:.:...|:.....:.|
Zfish   102 GHPMYTYSAAALGQHP---------AL-------SY-------SYPHGSHHHHHPSDPLKLTASS 143

  Fly   331 GCGD-----SSAGSGRLSLPALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQPKFRRNRTT 390
            ...|     |:||   :.||                   :|.|..|   ::|.:...|.||.||.
Zfish   144 FQLDHWLRVSTAG---MMLP-------------------KMADFNG---QAQSNLLGKCRRPRTA 183

  Fly   391 FSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPS 455
            |:.:||.|||.:|..:.|.....|.::|....|:|.:|::||.|||.||:|.::......:|:..
Zfish   184 FTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQDAEK 248

  Fly   456 TSSSPT-PLVNPVVSPVSPIPVPVPVAVPESGQQKQPYPYSTSN-------MCNTSSSSSNSQPC 512
            ...... ..::.:......:         :||:..:...:..|:       |.|:|..||..:..
Zfish   249 QKGKGNHDKMDGLEKDYQKV---------DSGKSNRIRDFRDSDDEEGDNYMLNSSDCSSEDERT 304

  Fly   513 NTINP 517
            |.|:|
Zfish   305 NDISP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 2/13 (15%)
Homeobox 388..440 CDD:278475 21/51 (41%)
mnx1NP_001009885.1 Homeobox 180..233 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.