DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and pitx3

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_991238.1 Gene:pitx3 / 402974 ZFINID:ZDB-GENE-041229-4 Length:293 Species:Danio rerio


Alignment Length:283 Identity:85/283 - (30%)
Similarity:106/283 - (37%) Gaps:109/283 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 DSSAGSGRLSLPALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQP-------KFRRNRTTF 391
            ||.|.|..|||    .|||: ....|........|.|.......|...|       |.||.||.|
Zfish     8 DSEARSPALSL----SDSGT-PQHDPGCKGQDNSDTEKSHQNHTDESNPEDGSLKKKQRRQRTHF 67

  Fly   392 SPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWR---RHQRVNLIKQR-- 451
            :.:||.|||..|.::.||.::|||::|..|.|:||||:|||.|||||||   |:|:..|.|..  
Zfish    68 TSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFG 132

  Fly   452 ----------------------DSPSTSSSP--------------TPLVN-PVVSPVSPIP---- 475
                                  .:.|.:|||              :||.: |:.||.|.||    
Zfish   133 AQFNGLMQPYDDMYSGYSYNNWATKSLASSPLSAKSFPFFNSMNVSPLSSQPMFSPPSSIPSMNM 197

  Fly   476 ----VPVPVA-VPESGQQKQ---------------------PY-----PYSTSNMCNTSSSS--- 506
                ||..|| ||.||....                     ||     ||...:.||:|.:|   
Zfish   198 ASSMVPSAVAGVPGSGLNNLGNLNNLNSPTLNSAAVSAAACPYATTAGPYMYRDTCNSSLASLRL 262

  Fly   507 -----------------SNSQPC 512
                             ||..||
Zfish   263 KAKQHANFAYPAVQNPVSNLSPC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 29/51 (57%)
pitx3NP_991238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 21/65 (32%)
Cnd2 18..>79 CDD:303063 20/65 (31%)
Homeobox 64..116 CDD:278475 29/51 (57%)
OAR 251..268 CDD:281777 4/16 (25%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 255..268 2/12 (17%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:O35160 260..264 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.