DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment toe and PHOX2A

DIOPT Version :9

Sequence 1:	NP_524041.2	Gene:	toe / 39418	FlyBaseID:	FBgn0036285	Length:	640	Species:	Drosophila melanogaster
Sequence 2:	NP_005160.2	Gene:	PHOX2A / 401	HGNCID:	691	Length:	284	Species:	Homo sapiens

Alignment Length:	143	Identity:	56/143 - (39%)
Similarity:	76/143 - (53%)	Gaps:	33/143 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   380 DQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQR 444
            ::.|.||.||||:..||.|||:.|.::|||.:.|||:||.:..|:||||||||.|||||:|:.:|
Human    86 EKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQER 150

  Fly   445 VNLIK------------------QRDSPSTSSSPTP-------------LVNPVVSPVSPIPVPV 478
            ....|                  ..||..::.||||             |.:|.:|| ||:||.:
Human   151 AASAKGAAGAAGAKKGEARCSSEDDDSKESTCSPTPDSTASLPPPPAPGLASPRLSP-SPLPVAL 214

  Fly   479 PVAVPESGQQKQP 491
            . :.|..|...||
Human   215 G-SGPGPGPGPQP 226

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
toe	NP_524041.2	HTH	134..230	CDD:304362
toe	NP_524041.2	Homeobox	388..440	CDD:278475	32/51 (63%)
PHOX2A	NP_005160.2	Homeobox	94..147	CDD:365835	32/52 (62%)
PHOX2A	NP_005160.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	145..284		21/84 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000011
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.910