DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and msx2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002936749.1 Gene:msx2 / 394987 XenbaseID:XB-GENE-852974 Length:256 Species:Xenopus tropicalis


Alignment Length:207 Identity:59/207 - (28%)
Similarity:86/207 - (41%) Gaps:55/207 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 GCGDSSAGSGRLSLPALSPDSGSRDSRSPD--ADANRMIDIEGEDSE-----SQD----SDQPKF 384
            |...|:|||....|     ..|.|||.||.  ........::.|:||     |:|    |..|:.
 Frog    58 GVDASAAGSTPRHL-----HMGIRDSPSPPGLTKTFETSSVKSENSEDGTTWSKDGGSYSPPPRH 117

  Fly   385 --------------RRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNR 435
                          |:.||.|:..||..||::|.:..|..:..|.:.::...|:|.:|::||.||
 Frog   118 LSPSTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNR 182

  Fly   436 RAKWRRHQRVNLIKQRDS-----PSTSSSPTPLVNPVVS------------PVSPIPVPVPVAVP 483
            |||.:|.|...:.|.:.:     |...|.|.|:.:|:.:            ||.|||   ||   
 Frog   183 RAKAKRLQEAEIEKLKMAAKPILPPGFSIPFPINSPIQAASLYGSSYQFHRPVLPIP---PV--- 241

  Fly   484 ESGQQKQPYPYS 495
              |....|..||
 Frog   242 --GLYATPVGYS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 20/51 (39%)
msx2XP_002936749.1 Homeobox 134..188 CDD:365835 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.