DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and mix1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_988848.1 Gene:mix1 / 394439 XenbaseID:XB-GENE-485898 Length:357 Species:Xenopus tropicalis


Alignment Length:285 Identity:74/285 - (25%)
Similarity:110/285 - (38%) Gaps:93/285 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 GSR--DSRSPDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTR 414
            ||:  |.|:|..||:.:       ..||       ||.||.|:..|||.||:.|..:.||.::.|
 Frog    67 GSKETDPRNPVPDASLL-------PASQ-------RRKRTFFTQAQLDILEQFFQTNMYPDIHHR 117

  Fly   415 EKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVP 479
            |:||....:.|:|:||||.|||||.||         :.:.:|        .||::          
 Frog   118 EELARHIYIPESRIQVWFQNRRAKVRR---------QGAKAT--------KPVLA---------- 155

  Fly   480 VAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMSSKTSSVSSNQHMEEPAAAVATA 544
                       .:.||::.                   |:..|...|:.:.|......|.|.|.|
 Frog   156 -----------GHHYSSTF-------------------GATRSMFPSAPAPNSSSHPMATARAQA 190

  Fly   545 SPTASAPLSMGGENSAFRALPMTLPMPMTLPTASAAAFALSFARQYIAKYMGTP--LNLGHGSSP 607
            .|...:..:...::..|      ||.|.:....|...|.||.|         ||  .:|...||.
 Frog   191 QPMKDSQANKFHQSQGF------LPYPDSSCDVSRQRFLLSQA---------TPGTYHLPQTSSN 240

  Fly   608 IQAQSGRDH---QSEEREYEDEQEE 629
            |..|:|:.|   .:::..|.|..|:
 Frog   241 IYNQNGKPHIPLWNQQPLYTDMMEK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 26/51 (51%)
mix1NP_988848.1 Homeobox 90..143 CDD:278475 26/52 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.