DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Noto

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001007473.1 Gene:Noto / 384452 MGIID:3053002 Length:240 Species:Mus musculus


Alignment Length:94 Identity:36/94 - (38%)
Similarity:54/94 - (57%) Gaps:8/94 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 IDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVW 431
            :|:....:|...      :|.||||:.:||.||||.|.|.|......|.:||||..|:|.:|::|
Mouse   138 VDLRDHGTERHT------KRVRTTFNLQQLQELEKVFAKQHNLVGKERAQLAARLHLTENQVRIW 196

  Fly   432 FSNRRAKWRRHQRVNLIKQ--RDSPSTSS 458
            |.|||.|:::.|::.|...  .:.||:||
Mouse   197 FQNRRVKYQKQQKLKLPSSSVMEEPSSSS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 27/51 (53%)
NotoNP_001007473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Homeobox 153..204 CDD:278475 26/50 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..240 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.