DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and CG9876

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:225 Identity:77/225 - (34%)
Similarity:98/225 - (43%) Gaps:58/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 SDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDS---SAGSGRLSLPALSPDSGSRDSRSPDADAN 364
            |.|.|:.. .|||...|         |:|||.:   :..||.|      |..|...||.|     
  Fly    74 SKGKMAME-LSSNFGPT---------GAGCGGADRPAPCSGNL------PAGGGHHSRKP----- 117

  Fly   365 RMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQ 429
                                ||||||||..||..|||.|:::|||....||:||.:..|||||||
  Fly   118 --------------------RRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQ 162

  Fly   430 VWFSNRRAKWRRHQRVNLIKQRDSPSTSSS--PTPLVNPVVSPVSPIPVPVPVAVPESGQQKQPY 492
            |||.|||||:||::|  .:..|....|:..  |.|:.|. :...:.:|.|.|...|..|.....:
  Fly   163 VWFQNRRAKFRRNER--SVGSRTLLDTAPQLVPAPISNN-MHKYANMPHPHPQPPPPPGAYALNF 224

  Fly   493 -PY---STSNMCNT-----SSSSSNSQPCN 513
             |.   |..|..|.     ||.:|.|..|:
  Fly   225 GPLELRSCQNYTNCYGGFGSSGASGSGVCS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 33/51 (65%)
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 33/51 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450801
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.