DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and vax2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_919390.1 Gene:vax2 / 373869 ZFINID:ZDB-GENE-030904-8 Length:307 Species:Danio rerio


Alignment Length:284 Identity:79/284 - (27%)
Similarity:120/284 - (42%) Gaps:32/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 DGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLP---ALSPDSGSRDSRSP----DA 361
            ||......:..:::.....|..:.|.:..|:.|........|   |.:|.|.|.|....    |.
Zfish    10 DGIAEDRNHCGSNSLCRDRGRESKSRTEVGNRSPVQSSTDTPGTSASTPTSSSEDGHDKLLGVDP 74

  Fly   362 DANRMI---DIEGEDSE-----SQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLA 418
            |..|.|   |.:|...|     ..|.|:||  |.||:|:.|||..||.||.:..|.....|.:||
Zfish    75 DYCRRILVRDAKGTIREIVLPKGLDLDRPK--RTRTSFTAEQLYRLELEFQRCQYVVGRERTELA 137

  Fly   419 ARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVPVAVP 483
            .:..|||.:|:|||.|||.|.::.|..:..| |.|.::.|..|..:..::.....:.||.|   |
Zfish   138 RQLNLSETQVKVWFQNRRTKQKKDQTKDTDK-RSSSTSESLATCNILRLLEQGRLLSVPAP---P 198

  Fly   484 ESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMSSKTSSVSS------NQHMEEPAAAVA 542
            .:.....|:|.:.|.:.:.|.|:|:....:|..||:...:...|:||      :..:..|..::.
Zfish   199 PNPLLAHPHPGNGSLLGSPSVSTSSGVSSSTTPPGAGSGTFGLSLSSLSGTPPSPRLGVPPPSLC 263

  Fly   543 TASPTASA-----PLSMGGENSAF 561
            ...|..|.     |...|...|||
Zfish   264 FTMPLLSGAHHELPSGYGCGTSAF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 25/51 (49%)
vax2NP_919390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 12/59 (20%)
Homeobox 106..159 CDD:278475 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..175 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..254 14/59 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.