DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Rhox12

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001020072.1 Gene:Rhox12 / 363437 RGDID:1563789 Length:175 Species:Rattus norvegicus


Alignment Length:143 Identity:47/143 - (32%)
Similarity:70/143 - (48%) Gaps:25/143 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 GSGCGDSSA-GSGRLSLPALSPDSGSRDSRSPDADANRM-IDIEGE-------DSESQDSDQ--- 381
            |...|:.|. ||.:|....: ||   :|.|....|...: .|::.|       ..:||..:|   
  Rat    32 GGSFGEGSLNGSDKLKYEGI-PD---KDDRIYVGDVKYIGNDVKDEYRGSHQGSGDSQLEEQKNL 92

  Fly   382 -----PKFRRNRTT----FSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRA 437
                 |:|||.|..    .:|.||.|||..|:.:.||.|.||..||....|:|:||:.||..|||
  Rat    93 ASPTIPQFRRTRPRIQLGLTPRQLSELEDFFETTKYPDVITRRNLAKHLYLAESRVKRWFKRRRA 157

  Fly   438 KWRRHQRVNLIKQ 450
            ::|:.|:..::|:
  Rat   158 RYRKEQQTQMLKR 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 24/55 (44%)
Rhox12NP_001020072.1 homeodomain 101..163 CDD:238039 27/61 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.