DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and eve

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:426 Identity:93/426 - (21%)
Similarity:138/426 - (32%) Gaps:171/426 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 HPYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTHS 321
            |.|.:: ...:||....|.|:...|          |......:.||.......:||...|     
  Fly     2 HGYRTY-NMESHHAHHDASPVDQKP----------LVVDLLATQYGKPQTPPPSPNECLS----- 50

  Fly   322 NGHNTNSGSGCGDSSAGSGRLSLPALSPD---SGSRDSRSPDADANRMIDIEGEDSESQDSDQPK 383
                                      |||   :|||.|..| ||                   |.
  Fly    51 --------------------------SPDNSLNGSRGSEIP-AD-------------------PS 69

  Fly   384 FRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNL- 447
            .||.||.|:.:||..|||||.|.:|.....|.:|||:..|.|:.::|||.|||.|.:| ||:.: 
  Fly    70 VRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKR-QRIAVA 133

  Fly   448 ---IKQRDSPSTSSS-----------PTPLVNP------------VVSPVSPIPVPVPVAVPE-- 484
               ......|:.::|           |.|...|            ..:|:....:| |:.:|:  
  Fly   134 WPYAAVYSDPAFAASILQAAANSVGMPYPPYAPAAAAAAAAAAAVATNPMMATGMP-PMGMPQMP 197

  Fly   485 -------SGQQKQPYPYST------------------------SNMCNTSSSSSN---------- 508
                   ||....|.||..                        .:|..:|::.|:          
  Fly   198 TMQMPGHSGHAGHPSPYGQYRYTPYHIPARPAPPHPAGPHMHHPHMMGSSATGSSYSAGAAGLLG 262

  Fly   509 ---SQPCNT---------------INPGSKMSSKTSSVS--SNQHMEE-PAAAVATASPTASAPL 552
               |..|.|               :...|...|.|.|:|  .:.|.:. ..:.||.::|:..|| 
  Fly   263 ALPSATCYTGLGVGVPKTQTPPLDLQSSSSPHSSTLSLSPVGSDHAKVFDRSPVAQSAPSVPAP- 326

  Fly   553 SMGGENSAFRALPMTLPMP---MTLPTASAAAFALS 585
                     ..|..|.|:|   :.:|:|...|..:|
  Fly   327 ---------APLTTTSPLPAPGLLMPSAKRPASDMS 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 25/51 (49%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 25/51 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450827
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.