DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and prrx1b

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_017207930.1 Gene:prrx1b / 337089 ZFINID:ZDB-GENE-030131-9033 Length:267 Species:Danio rerio


Alignment Length:247 Identity:78/247 - (31%)
Similarity:112/247 - (45%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 NMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDADANRMIDIE 370
            |:.:..|.|.|:...........||...:|...:||..|.:....|||..::.           |
Zfish    29 NLQAKKNFSVSHLLDLEEAREMVGSQVDESVGETGRTMLESPGLTSGSDTTQQ-----------E 82

  Fly   371 GEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNR 435
            .|...|::..:.|.|||||||:..||..||:.|:::|||....||.||.|..|:||||||||.||
Zfish    83 NEQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNR 147

  Fly   436 RAKWRRHQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVP--------------VAVPESG 486
            |||:||::|..|..:..|...|.|..  |..|..|:.|.|.|.|              ...||.|
Zfish   148 RAKFRRNERAMLASKNASLLKSYSGD--VTAVEQPIVPRPAPRPNDYLSWGSAAPYSWYPRPEGG 210

  Fly   487 QQKQP---YPYSTSNMCN---TSSSSSNSQPCNTINPGSKMSSKTSSVSSNQ 532
            ..:.|   .|..::.|..   |.::::::|..|..|..:.:..|....:.||
Zfish   211 PMRVPQKMLPTESNTMATYPPTCANTTSTQGMNMANSIANLRLKAKEYNLNQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 31/51 (61%)
prrx1bXP_017207930.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.