Sequence 1: | NP_524041.2 | Gene: | toe / 39418 | FlyBaseID: | FBgn0036285 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_008827.2 | Gene: | HOXA7 / 3204 | HGNCID: | 5108 | Length: | 230 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 51/201 - (25%) |
---|---|---|---|
Similarity: | 80/201 - (39%) | Gaps: | 51/201 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 299 SSYGSDGNMSSN---------PNSSNSN---------TTHSNGHNTNS-------GSGCGDSSAG 338
Fly 339 SGRL-------SLPALSPD--SGSRDSRSPD-----ADANRMIDIEGEDSESQDSDQPKFRRNRT 389
Fly 390 TFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSP 454
Fly 455 STSSSP 460 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toe | NP_524041.2 | HTH | 134..230 | CDD:304362 | |
Homeobox | 388..440 | CDD:278475 | 20/51 (39%) | ||
HOXA7 | NP_008827.2 | Antp-type hexapeptide | 119..124 | 1/10 (10%) | |
Homeobox | 134..186 | CDD:278475 | 20/51 (39%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 187..230 | 2/20 (10%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |