DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and oc

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster


Alignment Length:405 Identity:106/405 - (26%)
Similarity:138/405 - (34%) Gaps:166/405 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 AAEFARAASYGYAIHPTH----PHPYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQPGGSG 298
            ||.|.::...|  .|| |    |||:.|.|    |.||...:|:   |..||.|....|:..|. 
  Fly     2 AAGFLKSGDLG--PHP-HSYGGPHPHHSVP----HGPLPPGMPM---PSLGPFGLPHGLEAVGF- 55

  Fly   299 SSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDADA 363
                |.|..               |.||.                                    
  Fly    56 ----SQGMW---------------GVNTR------------------------------------ 65

  Fly   364 NRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARV 428
                               |.||.||||:..|||.||..|.|:.||.:..||::|.:..|.|:||
  Fly    66 -------------------KQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRV 111

  Fly   429 QVWFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVPVAVPESGQQKQPYP 493
            ||||.|||||.|:    .|.:|:.|.|.|||                             |....
  Fly   112 QVWFKNRRAKCRQ----QLQQQQQSNSLSSS-----------------------------KNASG 143

  Fly   494 YSTSNMCNTSS-----------SSSNSQPCNTINPGSKMSSKTS--------------SVSSNQH 533
            ..:.|.|::||           ||||:   ||.:.|...|:|:|              |...|..
  Fly   144 GGSGNSCSSSSANSRSNSNNNGSSSNN---NTQSSGGNNSNKSSQKQGNSQSSQQGGGSSGGNNS 205

  Fly   534 MEEPAAAVATASPTASAPLSMGGENSAFRALPMTLPMPMTLPTASAAAFALSFARQYIAKYMGTP 598
            ....|||.|:|:...:|..|:...:|:|               .||||.|.|......|......
  Fly   206 NNNSAAAAASAAAAVAAAQSIKTHHSSF---------------LSAAAAAASGGTNQSANNNSNN 255

  Fly   599 LNLGHGSSPIQAQSG 613
            .|.|: |:|..:.||
  Fly   256 NNQGN-STPNSSSSG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 29/51 (57%)
ocNP_001356934.1 Homeobox 71..123 CDD:333795 29/51 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450831
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.