DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Hoxc10

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001295565.1 Gene:Hoxc10 / 315338 RGDID:1307250 Length:342 Species:Rattus norvegicus


Alignment Length:406 Identity:90/406 - (22%)
Similarity:143/406 - (35%) Gaps:108/406 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PHSLSPSTPILTQGAPPAAALGGIFCGGSAAAGPGAAAAAATNLNALASQHRLLELSRFGLRGYD 148
            |.:::|::     .|.|.||.||                                    |.| |:
  Rat     4 PRNVTPNS-----YAEPLAAPGG------------------------------------GER-YN 26

  Fly   149 LAQHMLSQQGAVSKLLGTLRPPGLI--------GGSKPKVATPTVVSKIEQ----------YKRE 195
            .:..|..|.|:... .|.:|..||.        ||| |.:|..|..|.:.|          |:.|
  Rat    27 RSAGMYMQSGSDFN-CGVMRGCGLAPSLSKRDEGGS-PNLALNTYPSYLSQLDSWGDPKAAYRLE 89

  Fly   196 NPTIFAWEIRERLITEGVCTNATAPSVSSINRILRNRAAERAAAEFARAASYGYAIHPTHPHPYT 260
            .|           :...:.:.:..|||...| :....:||:.|.....||.|      :||.|.:
  Rat    90 QP-----------VGRPLSSCSYPPSVKEEN-VCCMYSAEKRAKSGPEAALY------SHPLPES 136

  Fly   261 SF-------PTWPAHHPLWGAVPLATPPGGG------PAGAGGALQPGGSGSSYGSDGNMSSNPN 312
            ..       |::....|.:.|:. .||...|      |.....:|.|..........|...|.|.
  Rat   137 CLGEHEVPVPSYYRASPSYSALD-KTPHCAGANEFEAPFEQRASLNPRTEHLESPQLGGKVSFPE 200

  Fly   313 S--SNSNTTHSNGHNTNS---GSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDADANRMIDIEGE 372
            :  |:|.|...|...|..   |.....|.:...|......|||:...:::.         :|:.|
  Rat   201 TPKSDSQTPSPNEIKTEQSLVGPKASPSESEKERAKTADSSPDTSDNEAKE---------EIKAE 256

  Fly   373 DSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRA 437
            ::..........|:.|..::..|..||||||..:.|.....|.:::....|::.:|::||.|||.
  Rat   257 NTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRM 321

  Fly   438 KWRRHQRVNLIKQRDS 453
            |.::..|.|.|::..|
  Rat   322 KLKKMNRENRIRELTS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 25/113 (22%)
Homeobox 388..440 CDD:278475 18/51 (35%)
Hoxc10NP_001295565.1 COG5576 221..>331 CDD:227863 28/118 (24%)
Homeobox 271..325 CDD:395001 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.