DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and rx3

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_571302.1 Gene:rx3 / 30474 ZFINID:ZDB-GENE-990415-238 Length:292 Species:Danio rerio


Alignment Length:268 Identity:84/268 - (31%)
Similarity:113/268 - (42%) Gaps:73/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 PGGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSRDSRS 358
            |.|||.: |.|....|....||.   |.:|       .|         .|...:|||       .
Zfish    51 PYGSGKT-GKDTEHLSPKKDSNK---HFDG-------VC---------RSTVMVSPD-------L 88

  Fly   359 PDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTAL 423
            ||||..::.|        .::.:.|.|||||||:..||.|||:.|:|||||.|.:||:||.:..|
Zfish    89 PDADGGKLSD--------DENPKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELALKVNL 145

  Fly   424 SEARVQVWFSNRRAKWRRHQR--VNLIKQRDSP--------------------------STSSSP 460
            .|.||||||.||||||||.::  |:.||.::|.                          ||||||
Zfish   146 PEVRVQVWFQNRRAKWRRQEKLEVSSIKLQESSMLSIPRSGPLSLGSGLPLEPWLTGPISTSSSP 210

  Fly   461 TPLVNPVVSPVSPIP---VPVPVAVPESGQQKQPY------PYSTSNMCNTSSSSSNSQPCNTIN 516
            ...:...::|...:|   .|.......:.....|:      ||..|...: ..|...:.|.||..
Zfish   211 LQSLPSFITPQQAVPASYTPPQFLSSSTLNHSLPHIGAVCPPYQCSGFMD-KFSLQEADPRNTSI 274

  Fly   517 PGSKMSSK 524
            ...:|.:|
Zfish   275 ASLRMKAK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 33/51 (65%)
rx3NP_571302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Octapeptide motif 32..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..72 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..107 9/36 (25%)
Homeobox 110..162 CDD:278475 33/51 (65%)
OAR 268..284 CDD:281777 5/15 (33%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 272..285 3/11 (27%)
Nuclear localization signal. /evidence=ECO:0000255 278..282 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.