Sequence 1: | NP_524041.2 | Gene: | toe / 39418 | FlyBaseID: | FBgn0036285 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571302.1 | Gene: | rx3 / 30474 | ZFINID: | ZDB-GENE-990415-238 | Length: | 292 | Species: | Danio rerio |
Alignment Length: | 268 | Identity: | 84/268 - (31%) |
---|---|---|---|
Similarity: | 113/268 - (42%) | Gaps: | 73/268 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 294 PGGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSRDSRS 358
Fly 359 PDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTAL 423
Fly 424 SEARVQVWFSNRRAKWRRHQR--VNLIKQRDSP--------------------------STSSSP 460
Fly 461 TPLVNPVVSPVSPIP---VPVPVAVPESGQQKQPY------PYSTSNMCNTSSSSSNSQPCNTIN 516
Fly 517 PGSKMSSK 524 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toe | NP_524041.2 | HTH | 134..230 | CDD:304362 | |
Homeobox | 388..440 | CDD:278475 | 33/51 (65%) | ||
rx3 | NP_571302.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..27 | ||
Octapeptide motif | 32..39 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 53..72 | 7/19 (37%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 85..107 | 9/36 (25%) | |||
Homeobox | 110..162 | CDD:278475 | 33/51 (65%) | ||
OAR | 268..284 | CDD:281777 | 5/15 (33%) | ||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 272..285 | 3/11 (27%) | |||
Nuclear localization signal. /evidence=ECO:0000255 | 278..282 | 1/3 (33%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |