DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and rx1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_571300.2 Gene:rx1 / 30472 ZFINID:ZDB-GENE-990415-236 Length:330 Species:Danio rerio


Alignment Length:231 Identity:83/231 - (35%)
Similarity:109/231 - (47%) Gaps:62/231 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 GAVPLATPPGGGPAGAGGAL----QPGGSGSSYG-----SDGNMSSNPNSSNSNTTHSNGHNTNS 328
            ||..:|...||...|..|.|    ||      ||     .||  |..|..          |:.:.
Zfish    56 GANAVAHKVGGESLGEPGKLDQRVQP------YGHLPPLRDG--SEQPTF----------HDADM 102

  Fly   329 GSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQP--KFRRNRTTF 391
            .|...|...|..|.::.:        ||:|||               |.|.:||  |.|||||||
Zfish   103 FSNKCDGDLGDLRKAIES--------DSKSPD---------------SADGEQPKKKHRRNRTTF 144

  Fly   392 SPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRV--NLIKQRDSP 454
            :..||.|||:.|:|||||.|.:||:||.:..|.|.||||||.||||||||.:::  :.:|..|||
Zfish   145 TTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKIDASTMKLHDSP 209

  Fly   455 STSSSPTPLVNPVVSPVSP-------IPVPVPVAVP 483
            ..|.: .|.::|.|.|::.       :|.|:..|.|
Zfish   210 MLSFN-RPSMHPTVGPMNNSLPLDPWLPSPLSSATP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 33/51 (65%)
rx1NP_571300.2 Octapeptide motif 37..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..104 13/55 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..142 13/46 (28%)
Homeobox 141..193 CDD:278475 33/51 (65%)
OAR 302..318 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Nuclear localization signal. /evidence=ECO:0000255 312..316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.