DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and hoxb8b

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_571256.1 Gene:hoxb8b / 30420 ZFINID:ZDB-GENE-980526-291 Length:247 Species:Danio rerio


Alignment Length:191 Identity:53/191 - (27%)
Similarity:80/191 - (41%) Gaps:40/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 PLATPP-GGGPA-----GAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGD 334
            |..||. ||.|:     ..|.|.|.......:...|. ||.|::|...|..:..:.       ||
Zfish    27 PSYTPDLGGRPSVLYGHNTGSAFQHAAQFPDFYHHGT-SSFPHASYQQTPCAVAYP-------GD 83

  Fly   335 SSAGSGRLSLPALSPDSGSRDS--RSPDADANRMID----IEG--EDSESQDSDQPKF------- 384
            ::..       .|..|...:.|  .:||:|..:..|    :.|  :|.||.:....:.       
Zfish    84 ATGN-------ILGQDGLQKQSFFGAPDSDFTQFGDCNLKVSGIRDDLESAEPCTAQLFPWMRPQ 141

  Fly   385 ----RRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRR 441
                ||.|.|:|..|..||||||..:.|.....|.:::...||:|.:|::||.|||.||::
Zfish   142 ATGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 22/51 (43%)
hoxb8bNP_571256.1 Antp-type hexapeptide 134..139 0/4 (0%)
Homeobox 149..201 CDD:278475 22/51 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..247 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.