DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Rhox9

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001020045.1 Gene:Rhox9 / 298352 RGDID:1563844 Length:227 Species:Rattus norvegicus


Alignment Length:254 Identity:58/254 - (22%)
Similarity:84/254 - (33%) Gaps:66/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 FARAASYGYAIHPTHPHPYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQPGGSGSSYGSDG 305
            |.::.|.|..:.|...|..|:            .|..|...|.......|.|..||......:.|
  Rat    11 FQKSLSLGAEVDPEQQHGGTA------------VVSEAREVGDQSQRLVGGLVQGGLDQGQPTQG 63

  Fly   306 NMSSNPNSSNSNTTHSNGHNTNSGSGCGDSS--------AGSGRLSLPALSPDSGSRDSRSPDAD 362
            .::............|...........||..        ||.|     |..|:..:         
  Rat    64 QLAGGNLPQEEPAELSLAQEATGVEEEGDEKEEEMEARYAGDG-----AYGPEDNN--------- 114

  Fly   363 ANRMIDIEGEDSESQDSDQPKF--------------------RRNRTTFSPEQLDELEKEFDKSH 407
                :..|| |....|.:||:.                    |..|..|:..||.:||:.|.::.
  Rat   115 ----VQQEG-DQHPNDQEQPQQEAAIPEGNRGQQAGNRLVHPRHTRPRFTHSQLRDLERLFQETR 174

  Fly   408 YPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTPLVNP 466
            ||.:.||:.||....:.|:.||.||..||:.:||:.|  |:...:.|     |.|..||
  Rat   175 YPSLRTRKDLARWMGVPESDVQDWFRMRRSLFRRNSR--LLMFCELP-----PIPENNP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 20/51 (39%)
Rhox9NP_001020045.1 Homeobox 154..207 CDD:278475 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.