DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Hmx3

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001099772.1 Gene:Hmx3 / 293537 RGDID:1559927 Length:356 Species:Rattus norvegicus


Alignment Length:528 Identity:114/528 - (21%)
Similarity:156/528 - (29%) Gaps:249/528 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PAIPATATAGSQSPGAIMPMAAVPLPSHLQLLGSSAGGVGQPAAITPVSPTAATTVLAQPHSLSP 89
            |...|:.||.:..|   .|....|.|..                    ||.:...:|...|...|
  Rat     4 PGPDASGTASAPPP---QPPPQPPAPKE--------------------SPFSIRNLLNGDHHRPP 45

  Fly    90 STPILTQGAPPAAALGGIFCGGSAAAGPGAAAAAATNLNALASQHRLLELSRFGLRGYDLAQHML 154
            ..|     .||...|   |...||||...||||||.. .||.           |..|:.|:|   
  Rat    46 PKP-----QPPPRTL---FAPASAAAAAAAAAAAAAK-GALE-----------GAAGFALSQ--- 87

  Fly   155 SQQGAVSKLLGTLRPPGLIGGSKPKVATPTVVSKIEQYKRENPTIFAWEIRERLITEGVCTNATA 219
                     :|.|        :.|:...|                                    
  Rat    88 ---------VGDL--------AFPRFEIP------------------------------------ 99

  Fly   220 PSVSSINRILRNRAAERAAAEFARAASYGYAIHPTHPHPYTSFPTWPAHH----PLWGAVPLATP 280
                          |:|.|.                          |||:    |.|......||
  Rat   100 --------------AQRFAL--------------------------PAHYLERSPAWWYPYTLTP 124

  Fly   281 PGG---GPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRL 342
            .||   .|..:..||....|.:| |:|.: |.:|                               
  Rat   125 AGGHLPRPEASEKALLRDSSPAS-GTDRD-SPDP------------------------------- 156

  Fly   343 SLPALSPDSGSRDSRSPDADANRMIDIEGEDSE-------------------------SQD---- 378
             |....||....||:|||.     |.:|..|||                         |:|    
  Rat   157 -LLKADPDHKELDSKSPDE-----IILEESDSEEGKKEGEAVPGAAGTTVGATAATPGSEDWKAG 215

  Fly   379 SDQP------KFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRA 437
            :|.|      :.::.||.||..|:.:||..||...|...:.|..|||...|:|.:|::||.|||.
  Rat   216 ADSPEKKPACRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRN 280

  Fly   438 KWRRH------------------QRVNLIKQRDS-----PSTSSSPTPLVNPVVSPVSPIPV--- 476
            ||:|.                  .||.::...:|     .:.:.:|.|:..|:::  .|.||   
  Rat   281 KWKRQLAAELEAANLSHAAAQRIVRVPILYHENSAAEGAAAAAGAPVPVSQPLLT--FPHPVYYS 343

  Fly   477 -PVPVAVP 483
             ||..:||
  Rat   344 HPVVSSVP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 8/95 (8%)
Homeobox 388..440 CDD:278475 23/51 (45%)
Hmx3NP_001099772.1 Homeobox 230..284 CDD:395001 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.