DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Mixl1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001099449.1 Gene:Mixl1 / 289311 RGDID:1310011 Length:231 Species:Rattus norvegicus


Alignment Length:301 Identity:80/301 - (26%)
Similarity:110/301 - (36%) Gaps:94/301 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 AAERAAAEFARAASYGYAIHPTHPHPYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQPGGS 297
            ||.....:||..|               :|||:||.||....:|.|.|..|.|...         
  Rat     3 AAGSQQLQFAEGA---------------AFPTFPAAHPGGQLLPAARPATGLPPAP--------- 43

  Fly   298 GSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDAD 362
                                               .||.|       ||.:|...||..| |.|.
  Rat    44 -----------------------------------PDSRA-------PAATPCFPSRGPR-PAAQ 65

  Fly   363 ANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEAR 427
            ....:|..|....|.....|: ||.||:||.|||..||..|.::.||.::.||:|||.|.|.|:|
  Rat    66 TPTGLDPPGPSKGSAAPSAPQ-RRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESR 129

  Fly   428 VQVWFSNRRAKWRRH----------QRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVPVAV 482
            :||||.|||||.||.          :|.:.: .|.:|.|.:.       .:.|..|:...|...:
  Rat   130 IQVWFQNRRAKSRRQSGKSFQPLSSRREDFL-HRPAPGTEAR-------CLKPQLPLEADVNHVL 186

  Fly   483 PESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMSS 523
            ..|        .:...:|.:.|....:....:.:.|||:.|
  Rat   187 DSS--------MAGGGVCTSGSQGFETYSSLSEDIGSKLDS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 30/51 (59%)
Mixl1NP_001099449.1 PRK14971 <2..139 CDD:237874 61/203 (30%)
Homeobox 89..143 CDD:395001 30/53 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.