DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Mixl1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_038757.1 Gene:Mixl1 / 27217 MGIID:1351322 Length:231 Species:Mus musculus


Alignment Length:301 Identity:78/301 - (25%)
Similarity:111/301 - (36%) Gaps:94/301 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 AAERAAAEFARAASYGYAIHPTHPHPYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQPGGS 297
            ||.....:||..|               :||.:||.||....:|...|..|.||....:..|..:
Mouse     3 AAGSQQLQFAEGA---------------AFPIFPAAHPGGQLLPAMRPASGLPAAPHDSRAPAAT 52

  Fly   298 GSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPA-LSPDSGSRDSRSPDA 361
                      ...||..:|.|..:                       || |.|...|:.|.:|.|
Mouse    53 ----------QCFPNRDSSPTAQT-----------------------PAGLDPPGPSKGSAAPSA 84

  Fly   362 DANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEA 426
                                |: ||.||:||.|||..||..|.::.||.::.||:|||.|.|.|:
Mouse    85 --------------------PQ-RRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPES 128

  Fly   427 RVQVWFSNRRAKWRRH---------QRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVPVAV 482
            |:||||.|||||.||.         .|..:.....:|.|.:.......|:.:.|:.:|.|     
Mouse   129 RIQVWFQNRRAKSRRQSGKSFQPLSSRRGVFLHCPAPGTEARCLKPQLPLEADVNHVPDP----- 188

  Fly   483 PESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMSS 523
                      ..:...:|.:.|.|..:....:.:.|||:.|
Mouse   189 ----------SMTGGGVCTSGSQSFETYSSLSEDIGSKLDS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 30/51 (59%)
Mixl1NP_038757.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..93 25/123 (20%)
Homeobox 89..142 CDD:278475 30/52 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.