DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and DUX5

DIOPT Version :10

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_036281.2 Gene:DUX5 / 26581 HGNCID:3083 Length:197 Species:Homo sapiens


Alignment Length:61 Identity:27/61 - (44%)
Similarity:37/61 - (60%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 DQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWR 440
            |..|.||.||..:..|...|.:.|:|..:|.:..||:||..|.|.|:|:|:||.||||:.|
Human   117 DPQKGRRKRTAITGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH_ARSR 134..230 CDD:481197
Homeodomain 385..441 CDD:459649 25/56 (45%)
DUX5NP_036281.2 Homeodomain 54..98 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..127 5/9 (56%)
Homeodomain 122..177 CDD:459649 24/54 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.